[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS82156.1 tthe0 AAS82156.1 "bacitracin resistance protein (putative undecaprenol kinase)"
MGRVSAWEALLLGVVEGLTEFLPVSSTGHLTLLFHLLGLPVEEDPFLKTFLVAIQLGAIL
AVLLLYGRRLAADRALWLRIAVAFVPTGVIGFFFYPLIKGVILGNDAVVAFFLFFVGAVL
LFADRLAERAQYQDVKALPLARVAWIGVFQGLAALFPGTSRSGATILGGLLLGLNRQAAA
EFSFLLALPTMFAAVGYDLWKSAPEVPEGGWSLLLLGFLAALATALVTVRWMLAFVARHG
FRPFALYRMALAAVYAFFFLR
//