[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS82166.1"

            "SSU ribosomal protein S1P"
            ""

OrgPattern -------------------------------------------------------------------- 1222111111111111111-111111111111111111111111111111111111111111111111121111111111111211112222111121112111121112222222222211112111111111115554411-41222222222222222222211223222222222222212111112113222222223222222313313222222332123333211222222222222222232221111221111111112111111-1111111111111111111111111111111111111121111111114232333334334312444222232312112122222231132221112222111121111111111111111111111111111-111111111111111111111111111111122222112111111111111112111111111111111111111111-1111112212111111111111111111111111111111111111111112111111111111211111111111111111312331222322221444233323333343221111111111111111111111121111112322222211111112111121221121-1122111111122122222222222222-22222222122222222222221133222222222222222222222222211211111111111211222222111112311111111111-212112222222111213333222222222312211111111111111222221112211222222222222211222333311111111111-------------------------1111111-11111 --------------111--11111111111111111111111-11111111111111111111-11111111111-1-1111111111-12111111111----1--13-2-1122--1-111-221111711112---11-1421111-2----1-----------------111221H353144224-45122--12 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGII:Sequence :HHHHHHHHHHHHHHHHHTccccccccEEEEEcccTTcEEEEEEcTTccEEEccccEEEEc:Sec Str : ===============================:RP:SCP|30->105|1sroA|9e-13|36.8|73/76|b.40.4.5 : ============================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->102|PF00575|6e-07|41.4|68/74|S1 61: . . . * . .: 120 :PFNQLTTKPLSEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKIEAQEKWDRIQELYE:Sequence :ccTTTccHHHHHHHHHHHHcTTcHHHHHHHHTTccEEEEEccTTHHHHHHHHHHHHHHcG:Sec Str :============================================= :RP:SCP|30->105|1sroA|9e-13|36.8|73/76|b.40.4.5 : ==:RP:SCP|119->188|1sroA|1e-08|28.8|69/76|b.40.4.5 :============================================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|33->102|PF00575|6e-07|41.4|68/74|S1 121: . . + . . .: 180 :KGEPVTVTIKERVKGGVVAELDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRK:Sequence :TGGccEEEEEccTTHHHHHTcHHHHHHcTTccHHHHHHHHHHHHHHHHcHHHHHTTccGG:Sec Str :============================================================:RP:SCP|119->188|1sroA|1e-08|28.8|69/76|b.40.4.5 :============================================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 181: . * . . . .: 240 :GRVILSRRAVLEEEQKKAREAFLKSLEPGQVVEGTVVEVTDFGVFVNLGPVDGLVHRSEI:Sequence :GccccTTTTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHcEETEcTTcEE:Sec Str : XXXXXXXXXXXXXXXX :SEG|211->226|vvegtvvevtdfgvfv :======== :RP:SCP|119->188|1sroA|1e-08|28.8|69/76|b.40.4.5 : ==================================================:RP:SCP|191->279|2oceA4|6e-13|27.8|89/94|b.40.4.5 :============================================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 241: + . . . . *: 300 :TWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALIPDPWTTVAEKYPVGTRVRGK:Sequence :EccGGGccTTEEEETTEEEEcccEEEEEccccEEEEcccEEEEEcccccccccccEEEEE:Sec Str :======================================= :RP:SCP|191->279|2oceA4|6e-13|27.8|89/94|b.40.4.5 : ===========:RP:SCP|290->372|2ba0A1|5e-19|26.8|82/83|b.40.4.5 :============================================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 : $$$$$$$$:RP:PFM|293->361|PF00575|7e-10|46.4|68/74|S1 301: . . . . + .: 360 :VVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVLRLDPEERRLS:Sequence :EEEccTTEEEEEccccccEEEEGGGcTTccTTccHHHHccTTcEEEEEEEEEccTTccEE:Sec Str :============================================================:RP:SCP|290->372|2ba0A1|5e-19|26.8|82/83|b.40.4.5 : ==:RP:SCP|359->439|1jjgA|2e-16|12.3|81/102|b.40.4.5 :============================================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|293->361|PF00575|7e-10|46.4|68/74|S1 361: . . . * . .: 420 :LGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN:Sequence :EEccccccEEEcccEEEEccGGGGGGHHHHHHHHHHTcEEEEcTTcEEEEEccHHHHHHH:Sec Str :============ :RP:SCP|290->372|2ba0A1|5e-19|26.8|82/83|b.40.4.5 :============================================================:RP:SCP|359->439|1jjgA|2e-16|12.3|81/102|b.40.4.5 :============================================================:BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 :$ :RP:PFM|293->361|PF00575|7e-10|46.4|68/74|S1 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|381->439|PF00575|4e-11|49.2|59/74|S1 421: . . + . . .: 480 :PAALFKKGDEMEVVVLNIDPVEQRVSLSRKRLLPPPLPQEEERPRRARSGKERARRKGAP:Sequence :HHHHHHHHHccccTTHHEET :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|444->478|rvslsrkrllppplpqeeerprrarsgkerarrkg :=================== :RP:SCP|359->439|1jjgA|2e-16|12.3|81/102|b.40.4.5 :======== :BL:SWS|17->428|RS1_RHIME|9e-89|39.0|405/568 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|381->439|PF00575|4e-11|49.2|59/74|S1 481: . * . . . .: 540 :RREDRREYEYGAVAEYNLYDASSVPTTTATVKLGDLYGDLLASLGLEEEAEEKSRG :Sequence : :Sec Str : XXXXXXXXXXXXX :SEG|520->532|llaslgleeeaee