[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS82166.1 tthe0 AAS82166.1 "SSU ribosomal protein S1P"
MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGII
PFNQLTTKPLSEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKIEAQEKWDRIQELYE
KGEPVTVTIKERVKGGVVAELDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRK
GRVILSRRAVLEEEQKKAREAFLKSLEPGQVVEGTVVEVTDFGVFVNLGPVDGLVHRSEI
TWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALIPDPWTTVAEKYPVGTRVRGK
VVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVLRLDPEERRLS
LGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
PAALFKKGDEMEVVVLNIDPVEQRVSLSRKRLLPPPLPQEEERPRRARSGKERARRKGAP
RREDRREYEYGAVAEYNLYDASSVPTTTATVKLGDLYGDLLASLGLEEEAEEKSRG
//