[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS82289.1"

            "molybdopterin (MPT) converting factor, subunit 2"
            ""

OrgPattern 1111-211111111111-1111111--11111------111111111211111-11112111112--- 111-11--11-1-11--11-1-----22222-----11--1--1--12111-1111-1---1111111111-----------111111---------------11111----------------------1---1111111---1121121111111-----211121111------------11111---1-13333332313333331111113322111--11111111111111111111111111111-------1---11-1-----------------------------------------------------------------------------------1------------------1--1-11111-----111111111111111111111111-11111111111-1111111111111112-11--1--11111111111-1111111-----------------------------1---1-1111122212211111221111111121111111111111111111111111111111----------111------------------------111111---------------------------111112111-1-11111111111111111111----1-1------21211112221211112-222221121121222222211111111111111111111111112212222--211111111111---1---------2111111111111111111111111-11111111111221111111111---------1111111111111111111111111----111-11--------------------------------------------------11- ----111-----12111111111211-111111111111111111111111-11-1111111-----------1---------------11111-1------111--12---111121--11112212-321-12291113-1111111111-1111111111211-11211121-11171-11111-21111121111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGA:Sequence :EEEEEEEcHHHHHHHcccEEEEcccccccHHHHHHHHHTTcHHHHcTTcEEEETTEEccT:Sec Str :============================================================:RP:SCP|1->76|1vjkA|2e-17|36.8|76/87|d.15.3.1 : ==========================================================:BL:SWS|3->79|MOAD_ECOLI|4e-11|48.7|76/81 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->79|PF02597|5e-09|58.6|70/79|ThiS 61: . . . * . .: 120 :ETPLKEGDEVAFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRG:Sequence :TccccTTcEEEEEcccccccccccHHHcccccHHHHHHHccTTccEEEEEEEEcccEETT:Sec Str :================ :RP:SCP|1->76|1vjkA|2e-17|36.8|76/87|d.15.3.1 : ====================================:RP:SCP|85->214|1fm0E|6e-33|42.3|123/142|d.41.5.1 :=================== :BL:SWS|3->79|MOAD_ECOLI|4e-11|48.7|76/81 : ===================:BL:SWS|102->213|MOAE_BACHD|5e-31|46.4|112/156 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|8->79|PF02597|5e-09|58.6|70/79|ThiS : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->195|PF02391|2e-25|51.9|108/117|MoaE 121: . . + . . .: 180 :EEVAFLEYEAYPEMAEKVMAEILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHR:Sequence :EEccEEEEEEcHHHHHHHHHHHHHHHHHHcTTcEEEEEEEcEEEcTTcEEEEEEEEEccH:Sec Str :============================================================:RP:SCP|85->214|1fm0E|6e-33|42.3|123/142|d.41.5.1 :============================================================:BL:SWS|102->213|MOAE_BACHD|5e-31|46.4|112/156 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->195|PF02391|2e-25|51.9|108/117|MoaE 181: . * . . . .: 240 :KEAFAACQYAIDRVKQILPVWKKEHRKDGSFWVEGFAPEDKRL :Sequence :HHHHHHHHHHHHHHHHHccEEEEEEccccEEEEEc :Sec Str :================================== :RP:SCP|85->214|1fm0E|6e-33|42.3|123/142|d.41.5.1 :================================= :BL:SWS|102->213|MOAE_BACHD|5e-31|46.4|112/156 :$$$$$$$$$$$$$$$ :RP:PFM|88->195|PF02391|2e-25|51.9|108/117|MoaE