[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS82289.1 tthe0 AAS82289.1 "molybdopterin (MPT) converting factor, subunit 2"
MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGA
ETPLKEGDEVAFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRG
EEVAFLEYEAYPEMAEKVMAEILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHR
KEAFAACQYAIDRVKQILPVWKKEHRKDGSFWVEGFAPEDKRL
//