[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS82295.1"

            "putative phosphohydrolases"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------111---------------------------------------------------------------------------------------------------11---1--------------------------------------11-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVYARTPLSLRLFARMKRSVRLLVLSDQVHPHIHSPRFPENLPPFDLVLAAGDLPGAYLE:Sequence 61: . . . * . .: 120 :YVATKVRVPVLFVPGNHGEEWVLEEGRRKRPGGVVNLHGRLFRHQGRLFYGIGGVPRYRE:Sequence : X:SEG|120->133|egegqlsegellrl 121: . . + . . .: 180 :GEGQLSEGELLRLALKPFPLAFPRRLLLGHGVDVLLTHAPPPGPSAGEDFAHRGARAFLL:Sequence :XXXXXXXXXXXXX :SEG|120->133|egegqlsegellrl : XXXXXXXXXXXXXX :SEG|135->148|lkpfplafprrlll : XXXXXX:SEG|175->190|arafllfhrlfrprlh 181: . * . . . .: 240 :FHRLFRPRLHVHGHTPLLGANPERRHRTPLGVEVVHAQGYALIAL :Sequence :XXXXXXXXXX :SEG|175->190|arafllfhrlfrprlh