[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:degV.2"

degV        "probable degV protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------11-------------------1----------------1---------------------------------------------------------------------------------------------------1---------------------------1----1----11-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASTPTASSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLC:Sequence : ccccEEEEEGGGcccHHHHHHTTEEEEccEEEcTTEEEETTTTccHHHHHHHHH:Sec Str : ===================================================:RP:SCP|10->278|1pzxA|5e-38|20.9|258/278|c.119.1.1 : ===================================================:BL:SWS|10->278|Y1491_THETN|5e-15|23.1|268/280 61: . . . * . .: 120 :SGERLTTSQVAPEDLRKLYEALLRTHGRVVSVHVSGLLSGTVDTAKKVAQAFGERVKVLD:Sequence :TcccEEEEcccHHHHHHHHHHHHHHTTTccEEEEcccTTccHHHHHHHHHTTTTcEEEEc:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|84->102|rthgrvvsvhvsgllsgtv : XXX:SEG|118->144|vldswslsgglllvlerarrlleegva :============================================================:RP:SCP|10->278|1pzxA|5e-38|20.9|258/278|c.119.1.1 :============================================================:BL:SWS|10->278|Y1491_THETN|5e-15|23.1|268/280 121: . . + . . .: 180 :SWSLSGGLLLVLERARRLLEEGVAWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGL:Sequence :ccccTHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHTEEEEEEccccHHHHHTTcccGT:Sec Str :XXXXXXXXXXXXXXXXXXXXXXXX :SEG|118->144|vldswslsgglllvlerarrlleegva :============================================================:RP:SCP|10->278|1pzxA|5e-38|20.9|258/278|c.119.1.1 :============================================================:BL:SWS|10->278|Y1491_THETN|5e-15|23.1|268/280 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->275|PF02645|2e-12|32.3|130/210|DegV 181: . * . . . .: 240 :QRFVGGLLRILPVLEVREGRVHPGPRVRGFAEGIRKVAALFRRDFLEEARVYLAHAENPE:Sequence :TTccGGGGccccEEEEETTEEEEEcccHHHHHHHHHHHHHHTHHHTTcccEEEEEEEccH:Sec Str : X:SEG|240->253|egakalgealkagg :============================================================:RP:SCP|10->278|1pzxA|5e-38|20.9|258/278|c.119.1.1 :============================================================:BL:SWS|10->278|Y1491_THETN|5e-15|23.1|268/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->275|PF02645|2e-12|32.3|130/210|DegV 241: + . . . . *: 300 :GAKALGEALKAGGVEVLGALPAGAAVSVHTGPGTVAAFAGPRG :Sequence :HHHHHHHHHHHHccTTEEEEEccHHHHHHHcTTEEEEEEEE :Sec Str :XXXXXXXXXXXXX :SEG|240->253|egakalgealkagg :====================================== :RP:SCP|10->278|1pzxA|5e-38|20.9|258/278|c.119.1.1 :====================================== :BL:SWS|10->278|Y1491_THETN|5e-15|23.1|268/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|145->275|PF02645|2e-12|32.3|130/210|DegV