[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80932.1 tthe0 degV.2 "probable degV protein"
MASTPTASSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLC
SGERLTTSQVAPEDLRKLYEALLRTHGRVVSVHVSGLLSGTVDTAKKVAQAFGERVKVLD
SWSLSGGLLLVLERARRLLEEGVAWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGL
QRFVGGLLRILPVLEVREGRVHPGPRVRGFAEGIRKVAALFRRDFLEEARVYLAHAENPE
GAKALGEALKAGGVEVLGALPAGAAVSVHTGPGTVAAFAGPRG
//