[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:dsbA"

dsbA        "thiol:disulfide interchange protein dsbA"
            ""

OrgPattern -----------------------11--11--1----------------------------------4A -16--111112---1------5----------31-3-3-1---11-11----1-2-------1---2-221-----------1--------------------------1--------------------------44544---41-------1------------11-2-------------12322------111111111111111--11-1111----------------------------------1--------------------------------------------------------------------------------------------------1---------------------2--122211111111111111111111111111111-111131112121211112121211111-24112122222111111111---11111111111111---1111-11-1--12211--------------------------------------------------------------------------------------12--1----------223233-1-------------------------------1-------------1----1-1-------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1-------------------1-111111------------------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHC:Sequence : cccccTTTEEEccccccTTTccccEEEEEEcTTcHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|4->23|aivlvvlglallglgwilwg : ========================:RP:SCP|37->205|1z6mA1|4e-24|22.2|153/172|c.47.1.13 : ======================:BL:SWS|39->209|BDBD_BACAN|7e-16|30.9|165/217 : $$$$$$$$$$:RP:PFM|51->207|PF01323|7e-13|38.8|147/178|DSBA 61: . . . * . .: 120 :QNHALNVLPRLKAEYIDTGKVRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLF:Sequence :HHHHHHHHHHHHHTccTTcEEEEEEcccccGGGHHHHHHHHHHHHHHHTTcHHHHHHHHH:Sec Str : XXXXXXXXXX :SEG|99->108|aseaaacaae :============================================================:RP:SCP|37->205|1z6mA1|4e-24|22.2|153/172|c.47.1.13 :============================================================:BL:SWS|39->209|BDBD_BACAN|7e-16|30.9|165/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|51->207|PF01323|7e-13|38.8|147/178|DSBA 121: . . + . . .: 180 :RAAAGWGNLTGEALDRYLVDLAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGT:Sequence :HHHTTcccccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHTcccc:Sec Str :============================================================:RP:SCP|37->205|1z6mA1|4e-24|22.2|153/172|c.47.1.13 :============================================================:BL:SWS|39->209|BDBD_BACAN|7e-16|30.9|165/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|51->207|PF01323|7e-13|38.8|147/178|DSBA 181: . * . . . .: 240 :PTFFIAGEKHTGFLPYEEWKRLLDEALAKAE :Sequence :cEEEETTTcGGGcccHHHHHHHHHHHHHcHH :Sec Str :========================= :RP:SCP|37->205|1z6mA1|4e-24|22.2|153/172|c.47.1.13 :============================= :BL:SWS|39->209|BDBD_BACAN|7e-16|30.9|165/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|51->207|PF01323|7e-13|38.8|147/178|DSBA