[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80819.1 tthe0 dsbA "thiol:disulfide interchange protein dsbA"
MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHC
QNHALNVLPRLKAEYIDTGKVRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLF
RAAAGWGNLTGEALDRYLVDLAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGT
PTFFIAGEKHTGFLPYEEWKRLLDEALAKAE
//