[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:fecD"

fecD        "iron(III) dicitrate transport system permease protein fecD"
            ""

OrgPattern ---------------------------------------------1111-1---11111--------- -------1111----------1---2----------13----------------------11--1----11------------------------------------12----------------11--1---1--1121111-3---------------------1----------------1-11111-1--11111111-1111111111-1111-112-1-------22--------------------1--------------------------------1--------------------------1----------12-12222132231-----11114-------1111---11-------------------------------------------------------------1-------------1------1-----------------------------------------------------111111----1-1111----1111-1------1----------1-1-------1--11--------------1-2------------------1-------2-------------------------------1----1---1111---1--1---11-------1-------1-11-1--111-111---1---111-1-111------1-1--1111-111111111111111--1----1-----------------------------------1---------------------------211----1-111---------1---11111111111--------------------------------1-----------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTRALPPALARGLVFLWLVALLLGAVALGVGLGAVAVPPEAVVRALLGLEENPIVTELRL:Sequence : ccccGGGTcH:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|12->47|glvflwlvalllgavalgvglgavavppeavvrall : =======:RP:SCP|54->337|1l7vA|7e-24|22.9|271/324|f.22.1.1 : =========:BL:SWS|52->335|Y087_METJA|3e-17|29.7|283/349 : $$$$$$$:RP:PFM|54->337|PF01032|3e-16|29.1|275/313|FecCD 61: . . . * . .: 120 :PRVLAGVLVGAALGVSGAAFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQ:Sequence :HHHHHHHHHHHHHHHHHHHHHHHTTcTTccTTcccHHHHHHHHHHH HHHTT ccH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|63->79|vlagvlvgaalgvsgaa :============================================================:RP:SCP|54->337|1l7vA|7e-24|22.9|271/324|f.22.1.1 :============================================================:BL:SWS|52->335|Y087_METJA|3e-17|29.7|283/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|54->337|PF01032|3e-16|29.1|275/313|FecCD 121: . . + . . .: 180 :HAVFQHLPLSATFFGFVGALSATLLTLVLAGGVARTGELVLAGVVVGSVLTGLTTYLMMQ:Sequence :HHHH HHHHHHHH :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|137->154|vgalsatlltlvlaggva : XXXXXXXXXXXXXXXXXXXX :SEG|156->175|tgelvlagvvvgsvltgltt :============================================================:RP:SCP|54->337|1l7vA|7e-24|22.9|271/324|f.22.1.1 :============================================================:BL:SWS|52->335|Y087_METJA|3e-17|29.7|283/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|54->337|PF01032|3e-16|29.1|275/313|FecCD 181: . * . . . .: 240 :DADRVRAVFAYTLGNLAFAGWEGVRVLALFFALAFPPLLFLGRVLNALGLGEETARSLGL:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|207->221|lalffalafppllfl : XXXX:SEG|237->264|slglplealkllllgaaslltasavaqa :============================================================:RP:SCP|54->337|1l7vA|7e-24|22.9|271/324|f.22.1.1 :============================================================:BL:SWS|52->335|Y087_METJA|3e-17|29.7|283/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|54->337|PF01032|3e-16|29.1|275/313|FecCD 241: + . . . . *: 300 :PLEALKLLLLGAASLLTASAVAQAGIIGFVGLVTPHLLRRLLGEDYRLLLPASALGGGAL:Sequence : ccccccccHHHHHHHHTTcccHHHHHHHHHHHHHHH:Sec Str :XXXXXXXXXXXXXXXXXXXXXXXX :SEG|237->264|slglplealkllllgaaslltasavaqa : XXXXXXXXXXXXXX:SEG|287->315|rlllpasalgggallaladllartlarpa :============================================================:RP:SCP|54->337|1l7vA|7e-24|22.9|271/324|f.22.1.1 :============================================================:BL:SWS|52->335|Y087_METJA|3e-17|29.7|283/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|54->337|PF01032|3e-16|29.1|275/313|FecCD 301: . . . . + .: 360 :LALADLLARTLARPAELPVGVVTTLLGGPFFLYLMWRRRGRA :Sequence :HHHHHHHHHHccccccccHHHHHHHHHHHHHHHHH :Sec Str :XXXXXXXXXXXXXXX :SEG|287->315|rlllpasalgggallaladllartlarpa :===================================== :RP:SCP|54->337|1l7vA|7e-24|22.9|271/324|f.22.1.1 :=================================== :BL:SWS|52->335|Y087_METJA|3e-17|29.7|283/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|54->337|PF01032|3e-16|29.1|275/313|FecCD