[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80739.1 tthe0 fecD "iron(III) dicitrate transport system permease protein fecD"
MTRALPPALARGLVFLWLVALLLGAVALGVGLGAVAVPPEAVVRALLGLEENPIVTELRL
PRVLAGVLVGAALGVSGAAFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQ
HAVFQHLPLSATFFGFVGALSATLLTLVLAGGVARTGELVLAGVVVGSVLTGLTTYLMMQ
DADRVRAVFAYTLGNLAFAGWEGVRVLALFFALAFPPLLFLGRVLNALGLGEETARSLGL
PLEALKLLLLGAASLLTASAVAQAGIIGFVGLVTPHLLRRLLGEDYRLLLPASALGGGAL
LALADLLARTLARPAELPVGVVTTLLGGPFFLYLMWRRRGRA
//