[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:livG.4"

livG        "branched-chain amino acid transport ATP-binding protein livG"
            ""

OrgPattern KJ85AA76AA88A6B7N5HGFGHLcABKTANO829885676738L8GFBBODB7DJGGGDF555K132 8BLAvB7CIHH6658B966-6I44Cm666669PJLKOYndKbIkHUD7JKF7QHO56F45LOl8bSSiagIFA99LFFA8J8W23516887626454--36D389C6IB61111111323222257A669668BE8QPOabAA9RMICJNCCPOUBB856756HJHKRPXD983453663555OMMKKML4EGOQQSQSVYbOZXUXWYTOKKJMWZXDRUMLHHKLLLLIin8AAA99989999A9A98966HC98SQ78B9CIF9ALOD67DHBEGFKIIDCBCGQNIKJIIHGKIJHBAAA9BBABBBAAGCCDDDDDDDLcNXbYZYaZXYHZIKUMLEEEDhMNE9jFFHDaXHKMKPLDJH7FNABCFDDCCCB27447GE***HBPthpsdefbjebhcdd*-LP*JExOhj*D3**************5ABec*pktwrXi98999999jHJ4BQJZ112-------112322424322222----C46473d*zcxlnrquoaSRTQnn**aXaZNcmp*lsre4CcdYjNZQUup*y**JRLBE6DJBA9AA999DBBGUQGgiGKGcOHQSLLWAHFFBDGG99NPMPSYKe668767677653333333331652275KLT6HDB595IAABBB7ADCCCBB9B7BF93-2695C-1----dVhaEdKVWWSVUPUTU-WUUVTTSUSTXSUSTUSSVrytbhEECMMKLLNMNNNLKNKLMfPNMPQNQA-Zefgihgcfhih224578888ABBBB6QPcDCDLBH67979CDHH789986F58AMHSSQQOffnPWYVUPfad7565656656ABAFCEDDEFICBC67857655552233117D99568955555455H4D43325-3322333655322465222FQPBDIYJPK6H9 ----231-2--234211--------------------1111-----111--2121-2---------------------------------21111--------------13562C374342363CA391Ab6-44F33225146625314812F4563H22A15121235B25413121-12213411E-341-6432- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI:Sequence : ==========================================================:RP:SCP|3->250|1ji0A|6e-38|32.3|232/240|c.37.1.12 : ==========================================================:BL:SWS|3->250|BRAF_PSEAE|3e-58|46.4|248/255 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->102|PF00005|6e-04|42.9|56/123|ABC_tran 61: . . . * . .: 120 :LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPL:Sequence : X:SEG|120->137|larkeerkaleealslle :============================================================:RP:SCP|3->250|1ji0A|6e-38|32.3|232/240|c.37.1.12 :============================================================:BL:SWS|3->250|BRAF_PSEAE|3e-58|46.4|248/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->102|PF00005|6e-04|42.9|56/123|ABC_tran 121: . . + . . .: 180 :ARKEERKALEEALSLLEYVGLLHRKDELARNLPYGEQRKLEIARALALKPKLLLLDEPAA:Sequence :XXXXXXXXXXXXXXXXX :SEG|120->137|larkeerkaleealslle : XXXXXXXXXXXXXXXXXX:SEG|163->180|aralalkpklllldepaa :============================================================:RP:SCP|3->250|1ji0A|6e-38|32.3|232/240|c.37.1.12 :============================================================:BL:SWS|3->250|BRAF_PSEAE|3e-58|46.4|248/255 181: . * . . . .: 240 :GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVR:Sequence :============================================================:RP:SCP|3->250|1ji0A|6e-38|32.3|232/240|c.37.1.12 :============================================================:BL:SWS|3->250|BRAF_PSEAE|3e-58|46.4|248/255 : $$$$$$$$$$:RP:PFM|231->250|PF12399|3e-04|85.0|20/23|BCA_ABC_TP_C 241: + . . . . *: 300 :TNPRVIEAYLGRGAAGGAA :Sequence : XXXXXXXX :SEG|251->258|grgaagga :========== :RP:SCP|3->250|1ji0A|6e-38|32.3|232/240|c.37.1.12 :========== :BL:SWS|3->250|BRAF_PSEAE|3e-58|46.4|248/255 :$$$$$$$$$$ :RP:PFM|231->250|PF12399|3e-04|85.0|20/23|BCA_ABC_TP_C