[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81311.1 tthe0 livG.4 "branched-chain amino acid transport ATP-binding protein livG"
MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRI
LFLGQDITGSTPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPL
ARKEERKALEEALSLLEYVGLLHRKDELARNLPYGEQRKLEIARALALKPKLLLLDEPAA
GMNPKETEALQEFILKIRSEMGLTILLIEHDMRLVMRISDRIAVLDYGSKIAEGKPEEVR
TNPRVIEAYLGRGAAGGAA
//