[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:lysR.1"

lysR        "transcriptional regulatory protein, lysR family"
            ""

OrgPattern -------------------------------------------------------------------- -1--1----------------1---1----------1212-1------------1-----------2-1-------------4-------------------------1----------------------------11-------1--1----------------21-2-------------11111---1-1111111111111111--1111111-------------1----------------------------------11-----------------------------------------------------------------------------------------------------------------------1----------1111111-1---------11----111----1211--2----1-----------------11------------------------------------22---53133444432222222622222-34241421--21111-1-21--2--1-----1-----------------------1111-----------11-1-1------------------------------------------------------------------------11--12-1111111111-111111111111111111111111---11111111111111111111---1----1-111-1111-----------------1---------------1111111-1-2-2232-3-1--1---------------------------------1-11----------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQALERELGVRLLERRPFRLTPAGD:Sequence :HHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcTTccEEEcHHHH:Sec Str : XXXXXXXXXXXXX :SEG|39->51|lerelgvrllerr :====================================== :RP:SCP|1->38|1b9mA1|2e-08|23.7|38/122|a.4.5.8 :============================================================:BL:SWS|1->237|BENM_ACIAD|5e-17|28.3|237/304 61: . . . * . .: 120 :LLRREGARLLKELEALKEAVRRAGQEALRFGVPENLLPDLMPLLDHLRRGLGQAVEVLEM:Sequence :HHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHTTTccHHHHHHHHHHcccccccTTcccc:Sec Str :XXXXXXXXXXXXXXXXXXX :SEG|61->79|llrregarllkelealkea : XXXXXXXXXXXX :SEG|96->107|llpdlmplldhl : ======:RP:SCP|115->232|1i69A|1e-11|25.5|110/206|c.94.1.1 :============================================================:BL:SWS|1->237|BENM_ACIAD|5e-17|28.3|237/304 : $$$$$$$$$$$$:RP:PFM|109->234|PF03466|5e-04|27.4|124/207|LysR_substrate 121: . . + . . .: 180 :HTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALK:Sequence :TTHHHHTcccEEHHHHcccccEEEEEEEccGGGccccTHHHHHHHTTccTTcEEEEcccE:Sec Str :============================================================:RP:SCP|115->232|1i69A|1e-11|25.5|110/206|c.94.1.1 :============================================================:BL:SWS|1->237|BENM_ACIAD|5e-17|28.3|237/304 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|109->234|PF03466|5e-04|27.4|124/207|LysR_substrate 181: . * . . . .: 240 :EEPFLLLPKDFLPPLYEAFMEVFRRAGFAPKVVREVARFSQAVSLVAAGLGVHLTLAPYR:Sequence :EEcEEEEEEEEcTTccEEEEEEEGGGcTTccTTcEEEEEEcGGGcEEEcccEEEEEGccc:Sec Str : XXXXXXXXXXXXX :SEG|183->195|pflllpkdflppl :==================================================== :RP:SCP|115->232|1i69A|1e-11|25.5|110/206|c.94.1.1 :========================================================= :BL:SWS|1->237|BENM_ACIAD|5e-17|28.3|237/304 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|109->234|PF03466|5e-04|27.4|124/207|LysR_substrate 241: + . . . . *: 300 :VYPHPGVVLRPLEEEAALEVALIYARRPPPPRLEEVRRLLRALAL :Sequence :c :Sec Str : XXXXXXXXXXXXXXXX :SEG|247->262|vvlrpleeeaaleval : XXXXXXXXXXXXXXXXXXXX :SEG|265->284|arrpppprleevrrllrala