[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS82142.1 tthe0 lysR.1 "transcriptional regulatory protein, lysR family"
MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQALERELGVRLLERRPFRLTPAGD
LLRREGARLLKELEALKEAVRRAGQEALRFGVPENLLPDLMPLLDHLRRGLGQAVEVLEM
HTPEQVRALKEGRLDYGLAGLKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALK
EEPFLLLPKDFLPPLYEAFMEVFRRAGFAPKVVREVARFSQAVSLVAAGLGVHLTLAPYR
VYPHPGVVLRPLEEEAALEVALIYARRPPPPRLEEVRRLLRALAL
//