[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:pilT.2"

pilT        "pili retraction protein pilT"
            ""

OrgPattern ---------------------------------11--------------------------------- 153-------------------------------------5---3---3----3--------3-----------------3-346634-------------11---1-21111111111111111----------------444--6333333334431233333333333-3--2-23--2-444434422311111111111111-11111111113331122-------21111111111111111111111-1111111111111-11111---11111111111-----------111111111111121111111112222222222223232333333312411-3335336342332222222216561111-----211221---1--1------------111-61---1--1-----1------1122----------1111111111121--211---------------------------2-111-22--1422245244423322444424262445511557A996678CA79659799B524444444542A993877467--53333-AABD987996666975513333111111-1-------2454454665598546555567556555555555565--34558------32341243333344434-333535533334343344333333342222222224233232232131111--533333343933--A622222555545831111111111111111555652545256799755677444557672221122123477655545555557777A776664444--2-111111------------------------------------2212222222-84 --------------------------------------------------------------------------------------------------------------------------------------------------------------2----3------1-----------------2-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMD:Sequence : TccEEEEccccccEEEETTEEEcTTcccccccTTHHHccccGG:Sec Str :============================================================:RP:SCP|1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11 : =======================================================:BL:SWS|6->349|PILT_PSEAE|8e-97|51.6|343/344 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->273|PF00437|7e-38|44.0|252/273|GSPII_E 61: . . . * . .: 120 :EKQQRIFEEEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIA:Sequence :GcccccccccccccTTcccccccHHHHTTTccHHTTTccGGGEEEcccccEEEcTHHTTc:Sec Str :============================================================:RP:SCP|1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11 :============================================================:BL:SWS|6->349|PILT_PSEAE|8e-97|51.6|343/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->273|PF00437|7e-38|44.0|252/273|GSPII_E 121: . . + . . .: 180 :EIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQR:Sequence :cccEEEEEEEccccTTcccHHHHHHHHHHcccccTccccccTTcccTccHHHTTHHHHHH:Sec Str :============================================================:RP:SCP|1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11 :============================================================:BL:SWS|6->349|PILT_PSEAE|8e-97|51.6|343/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->273|PF00437|7e-38|44.0|252/273|GSPII_E 181: . * . . . .: 240 :EIGSDTKSFHKALRSVLRQAPDVILVGEMRDYETIAAAITAAETGHLVMGTLHTNSAPET:Sequence :HHHTTTHEEEEEEEEEEHHHHHHHHHHccccccTTcTTccEEEcccHHHHTTccccccEE:Sec Str : XXXXXXXXXXXX :SEG|213->224|etiaaaitaaet : ############### :PROS|197->211|PS00662|T2SP_E|PDOC00567| :============================================================:RP:SCP|1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11 :============================================================:BL:SWS|6->349|PILT_PSEAE|8e-97|51.6|343/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->273|PF00437|7e-38|44.0|252/273|GSPII_E 241: + . . . . *: 300 :IDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVRALIRE:Sequence :EEEEEEETTcGGGEEEccccTTcHHHHHHHHHHHTccccccccEEEEccccccccEEEEc:Sec Str :============================================================:RP:SCP|1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11 :============================================================:BL:SWS|6->349|PILT_PSEAE|8e-97|51.6|343/344 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->273|PF00437|7e-38|44.0|252/273|GSPII_E 301: . . . . + .: 360 :GKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFMRLAGAPEGAR:Sequence :HTTcHHHHccccEEEEcccccHHHHHHHHHTTcEEEEEEcccccccccccccccccc :Sec Str :====== :RP:SCP|1->306|1p9rA|2e-49|32.0|291/378|c.37.1.11 :================================================= :BL:SWS|6->349|PILT_PSEAE|8e-97|51.6|343/344 361: . . . * . .: 420 :R :Sequence : :Sec Str