[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81963.1 tthe0 pilT.2 "pili retraction protein pilT"
MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMD
EKQQRIFEEEKELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIA
EIAMSPRGLVLVTGPTGSGKSTTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQR
EIGSDTKSFHKALRSVLRQAPDVILVGEMRDYETIAAAITAAETGHLVMGTLHTNSAPET
IDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGGRVLAYELMIATPAVRALIRE
GKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFMRLAGAPEGAR
R
//