[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:rbsC"

rbsC        "ribose transport system permease protein rbsC"
            ""

OrgPattern 221-11------------21111121111-1-----------------------1111111---2--- ----1---------------------------------1-----21111221111-11--1132111211--------1---1------------------------------------------1111122111222221---11-1-----12------------1111------------11-2222-111--1-111111111111---11111111211111111122--------------------11-1--1--1----------11111111111-111111111111111111111111111111111111111122211111111122---2222411111--1111-2-1122111112-12-------------112---1-1--11111111112-2121--3-24--4224533445661----3323333323---------22---12-----------------------------------1-----------------31--------21211--111411-1111131-2-----1------------1-2-2-1122--1111----------111113-1---------------------------112-------1-------2------2--1----------------------------------------------------------------------------------------------------------------2-2---------------------1----11111-11-----12233-----------------------------------------1------11111111111----1-11-1111111111111---1521114111--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLDAAFLTALLLSTLRQTAPLLLTALGGMFSERSGVVNIALEGILLFGALTAAVVVERL:Sequence : XXXXXXXXXXXXXXXXXX :SEG|3->20|ldaafltalllstlrqta : XXXXXXXXXXX:SEG|50->64|altaavvverleaal : ========================================:BL:SWS|21->307|YUFQ_BACSU|1e-50|48.8|281/319 61: . . . * . .: 120 :EAALGPGPHPWLPWVGVLAAMGVGGLVAFVHALVSIKYRADQIISATAINLLALGAPSLV:Sequence :XXXX :SEG|50->64|altaavvverleaal : XXXXXXXXXXXXXX :SEG|75->88|vgvlaamgvgglva :============================================================:BL:SWS|21->307|YUFQ_BACSU|1e-50|48.8|281/319 121: . . + . . .: 180 :LTYFYGNATSSKEVENRLPLWGPEGFQLSPLVYAAFLLVPLTWWVLFKTPFGLRLRAVGE:Sequence :============================================================:BL:SWS|21->307|YUFQ_BACSU|1e-50|48.8|281/319 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|151->267|PF02653|1e-06|34.5|116/271|BPD_transp_2 181: . * . . . .: 240 :HPEAADTLGVNVHRMRYVGVVLSGVLTGLAGAYLSIGFLNQFVRGMSAGMGFIALAALIF:Sequence : XXXXXXXXXXXXXX :SEG|198->211|vgvvlsgvltglag :============================================================:BL:SWS|21->307|YUFQ_BACSU|1e-50|48.8|281/319 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|151->267|PF02653|1e-06|34.5|116/271|BPD_transp_2 241: + . . . . *: 300 :GKWHPVGILFSTLLFGFASALAIQLQGSEILPAVLVQAFPYVVTVLVLAGFIGKSRPPAA:Sequence :============================================================:BL:SWS|21->307|YUFQ_BACSU|1e-50|48.8|281/319 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|151->267|PF02653|1e-06|34.5|116/271|BPD_transp_2 301: . . . . + .: 360 :VGKPYEK :Sequence :======= :BL:SWS|21->307|YUFQ_BACSU|1e-50|48.8|281/319