[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS81847.1 tthe0 rbsC "ribose transport system permease protein rbsC"
MSLDAAFLTALLLSTLRQTAPLLLTALGGMFSERSGVVNIALEGILLFGALTAAVVVERL
EAALGPGPHPWLPWVGVLAAMGVGGLVAFVHALVSIKYRADQIISATAINLLALGAPSLV
LTYFYGNATSSKEVENRLPLWGPEGFQLSPLVYAAFLLVPLTWWVLFKTPFGLRLRAVGE
HPEAADTLGVNVHRMRYVGVVLSGVLTGLAGAYLSIGFLNQFVRGMSAGMGFIALAALIF
GKWHPVGILFSTLLFGFASALAIQLQGSEILPAVLVQAFPYVVTVLVLAGFIGKSRPPAA
VGKPYEK
//