[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:thiS"

thiS        "putative thiS protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVAL:Sequence : EEETTEEEccTTccHHHHHHHTTccGGGEEEEETTEEEEGGGcccccccTTcEEEEEEc:Sec Str : ===========================================================:RP:SCP|2->63|2cu3A1|7e-24|96.8|62/63|d.15.3.2 : =========================================================:BL:SWS|4->64|THIG_MAGSA|1e-04|36.1|61/100 61: . . . * . .: 120 :MQGG :Sequence :cccc :Sec Str :=== :RP:SCP|2->63|2cu3A1|7e-24|96.8|62/63|d.15.3.2 :==== :BL:SWS|4->64|THIG_MAGSA|1e-04|36.1|61/100