[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80664.1 tthe0 thiS "putative thiS protein"
MVWLNGEPRPLEGKTLKEVLEEMGVELKGVAVLLNEEAFLGLEVPDRPLRDGDVVEVVAL
MQGG
//